DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCL7-like and bcl7b

DIOPT Version :9

Sequence 1:NP_572562.1 Gene:BCL7-like / 31890 FlyBaseID:FBgn0026149 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001096542.1 Gene:bcl7b / 100125186 XenbaseID:XB-GENE-973849 Length:189 Species:Xenopus tropicalis


Alignment Length:114 Identity:52/114 - (45%)
Similarity:69/114 - (60%) Gaps:14/114 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSVRAETRSRAKDDIKRVMQAVDKVRHWEKKWVTISDTTMKIYKWVPIASASEKKAKLESSPGSA 67
            ||||||||||||||||:||.|::.||.|||||||:.||:::|:||||:....:|:....|.|...
 Frog     4 RSVRAETRSRAKDDIKKVMAAIENVRRWEKKWVTVGDTSLRIFKWVPVIDGKDKEKMKGSVPADG 68

  Fly    68 AVRRPPPGSGV-------TPVGGSKSD----KENSQKGTPTPPQ-ITPS 104
            |.  .|..|.:       |....|.||    |..|...:|:||: ::||
 Frog    69 AA--TPANSSLLLEFQDETSNQSSLSDVYQPKVESSTSSPSPPRSVSPS 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCL7-likeNP_572562.1 BCL_N 2..49 CDD:282557 33/45 (73%)
bcl7bNP_001096542.1 BCL_N 4..50 CDD:368074 33/45 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7800
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4853
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517597at2759
OrthoFinder 1 1.000 - - FOG0001798
OrthoInspector 1 1.000 - - otm49189
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2423
SonicParanoid 1 1.000 - - X1157
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.