DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPH3 and glo

DIOPT Version :9

Sequence 1:NP_001309363.1 Gene:HNRNPH3 / 3189 HGNCID:5043 Length:346 Species:Homo sapiens
Sequence 2:NP_650120.1 Gene:glo / 41431 FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster


Alignment Length:461 Identity:136/461 - (29%)
Similarity:184/461 - (39%) Gaps:186/461 - (40%)


- Green bases have known domain annotations that are detailed below.


Human    10 PNDASD--------GT---VRLRGLPFGCSKEEIVQFFQGLEIVPN--GITLTMDYQGRSTGEAF 61
            |.:|.:        ||   |:|||||:..::::|.:||.||:|..:  ||...||.:||:|||||
  Fly   129 PKEAKEAMRKISGHGTAFVVKLRGLPYAVTEQQIEEFFSGLDIKTDREGILFVMDRRGRATGEAF 193

Human    62 VQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIK-------GFYDPPRRLLGQRPGPYD---- 115
            |||.|::..|.|||:::|:||||||||||||.:|:|       |        :|.||||||    
  Fly   194 VQFESQDDTEQALGRNREKIGHRYIEIFRSSIAEMKRATGAGGG--------VGGRPGPYDIRDR 250

Human   116 ------------RPIGGRGGYYGAGRGSMY------DRMRRG----------------------- 139
                        |...|..|.:|.|..:|.      ..|..|                       
  Fly   251 GANRGGNDFGGGRNDWGNNGNFGVGANNMLGFNNLPSLMNSGNFGNNQGGNNGNFGNNSGPSNFG 315

Human   140 --GDGYDGG-------------------------YGG-------------FDDYGGYNNYG---- 160
              |.|.:||                         :||             |:..||.||:|    
  Fly   316 NFGGGNNGGNSGNFGNDSGNSGNFGNFGNNGGGNFGGNNNGGGGFNSGNNFNSPGGVNNFGNNGG 380

Human   161 ---------------------------------------YGNDGFDD---RMRDGRGMGGHGYGG 183
                                                   :||.||.:   ....|...||...||
  Fly   381 SNFGGNGGGGFNNGGNFVSSSGVGNFGPIGGGRNNNNGNFGNSGFGNFGGNNNVGSNFGGGNNGG 445

Human   184 AGDASSGFH---------GGHF---------------VHMRGLPFRATENDIANFFSPLNPIRVH 224
            .|..::|.:         ||:|               :||||||:.:.|||:..||.|:.|..|.
  Fly   446 GGGFNNGSNFGGGNSMGGGGNFGPIGGGRGNDIEYYTIHMRGLPYTSFENDVFKFFEPIRPANVR 510

Human   225 IDIGADGRATGEADVEFVTHEDAVAAMSKDKNNMQHRYIELFLN-STPG--GGSGMGGSGMGGYG 286
            |:....|..:|.||..|.|:||:..||.:.:..|..||||||.: .|.|  ||...||:|.||.|
  Fly   511 INYNKKGLHSGTADAYFDTYEDSQVAMKRHREQMGSRYIELFYDGKTRGLNGGEHGGGNGGGGMG 575

Human   287 RDGMDN 292
            .:|..|
  Fly   576 NNGGGN 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPH3NP_001309363.1 RRM2_hnRNPH3 1..93 CDD:410131 47/95 (49%)
RRM3_hnRNPH3 195..269 CDD:241179 33/89 (37%)
gloNP_650120.1 RRM_SF 51..125 CDD:302621
RRM2_hnRNPH_like 146..224 CDD:240948 42/77 (55%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950 32/73 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155220
Domainoid 1 1.000 78 1.000 Domainoid score I8778
eggNOG 1 0.900 - - E1_KOG4211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I3313
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D392876at33208
OrthoFinder 1 1.000 - - FOG0000855
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13976
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X436
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.