DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and TMPRSS5

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:261 Identity:73/261 - (27%)
Similarity:115/261 - (44%) Gaps:16/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QHLTLRDTEQVHAEIQPLIIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCV 87
            |.::||.:|.....:...|:.|..| .....|:..|::|   .:.|.||.|::..||::|||||:
Human   200 QVVSLRCSECGARPLASRIVGGQSV-APGRWPWQASVAL---GFRHTCGGSVLAPRWVVTAAHCM 260

  Fly    88 DELRTFNGDAVGTPVYAGIINRSNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNAR 152
            ...|.  .......|:||:::.|.|...|...|:....|..::......::|||.:..:..::..
Human   261 HSFRL--ARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDT 323

  Fly   153 VQQIALPDINDDYSNKTAAAY--GWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQ 215
            |..:.|| ..:.:..|.:..:  |||.|.|.....|..||....||.::..|.........||.:
Human   324 VGAVCLP-AKEQHFPKGSRCWVSGWGHTHPSHTYSSDMLQDTVVPLFSTQLCNSSCVYSGALTPR 387

  Fly   216 QVCS-----QVKTCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQ 275
            .:|:     :...|.||.|.||: .|......|||:.||. ..|...|.|.||..|..::.|||.
Human   388 MLCAGYLDGRADACQGDSGGPLV-CPDGDTWRLVGVVSWG-RGCAEPNHPGVYAKVAEFLDWIHD 450

  Fly   276 T 276
            |
Human   451 T 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 68/241 (28%)
Tryp_SPc 41..273 CDD:214473 65/238 (27%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133 4/12 (33%)
Tryp_SPc 217..448 CDD:214473 65/239 (27%)
Tryp_SPc 218..451 CDD:238113 68/241 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.