DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Tmprss5

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:268 Identity:74/268 - (27%)
Similarity:114/268 - (42%) Gaps:14/268 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AAKLPHIQHLTLRDTEQVHAEIQPLIIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWL 80
            :|..|..:.::|:.:|.....:...|:.|..|.. ...|:..|:.|..   .|.||||::...|:
Mouse   193 SANCPSGRIVSLKCSECGARPLASRIVGGQAVAS-GRWPWQASVMLGS---RHTCGASVLAPHWV 253

  Fly    81 LTAAHCVDELRTFNGDAVGTPVYAGIINRSNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSE 145
            :|||||:...|.  .......|:||:::...|...|...|:....|..::......::|||.:..
Mouse   254 VTAAHCMYSFRL--SRLSSWRVHAGLVSHGAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRT 316

  Fly   146 SFEYNARVQQIALPDINDDYS-NKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPAD 209
            ...::..|..:.||.....:. .......|||.|||.....|..||....|||::..|.......
Mouse   317 PINFSDTVGAVCLPAKEQHFPWGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTYLCNSSCMYS 381

  Fly   210 APLTAQQVCS-----QVKTCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPY 269
            ..||.:.:|:     :...|.||.|.||: .|......|||:.||. ..|...|||.||..|..:
Mouse   382 GALTHRMLCAGYLDGRADACQGDSGGPLV-CPSGDTWHLVGVVSWG-RGCAEPNRPGVYAKVAEF 444

  Fly   270 IGWIHQTI 277
            :.|||.|:
Mouse   445 LDWIHDTV 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 69/240 (29%)
Tryp_SPc 41..273 CDD:214473 66/237 (28%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 4/19 (21%)
Tryp_SPc 217..448 CDD:214473 66/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.