DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:273 Identity:73/273 - (26%)
Similarity:118/273 - (43%) Gaps:46/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LAGAAKLPHIQHLTLRDTEQVHAEIQPLIIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGK 77
            |..|..||              |.....|:.||... ..:|||.|||:   ...:|.||.|:|..
Mouse    10 LGAAVALP--------------ANSDDKIVGGYTCP-KHSVPYQVSLN---DGISHQCGGSLISD 56

  Fly    78 RWLLTAAHCVD-ELRTFNGDAVGTPVYAGIINRSNVTAAQVRYVDFAS--THRSFNGNAGSDNIA 139
            :|:|:||||.. .|:...|:           :..:|.....:::|...  .|..:|.:...::|.
Mouse    57 QWVLSAAHCYKRRLQVRLGE-----------HNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIM 110

  Fly   140 LLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKE 204
            |:.:......|::|..::||. :...:|......|||.|...|.:|...||...||:|:::.||:
Mouse   111 LIKLKSPAILNSQVSTVSLPR-SCASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKK 174

  Fly   205 LLPADAPLTAQQVC-----SQVKTCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYT 264
            ..|..  :|:...|     ....:|.||.|.|::.     ..|:.|:.||..: |....:|.|||
Mouse   175 SYPGQ--ITSNMFCLGFLEGGKDSCDGDSGGPVVC-----NGEIQGIVSWGSV-CAMRGKPGVYT 231

  Fly   265 SVPPYIGWIHQTI 277
            .|..|:.||.:|:
Mouse   232 KVCNYLSWIQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 67/242 (28%)
Tryp_SPc 41..273 CDD:214473 65/239 (27%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 65/240 (27%)
Tryp_SPc 24..243 CDD:238113 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.