DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and prss1

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:289 Identity:80/289 - (27%)
Similarity:124/289 - (42%) Gaps:54/289 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LSPLFLLPLLALAGAAKLPHIQHLTLRDTEQVHAEIQPLIIDGYDVQGVDNVPYLVSLSLTRATY 66
            :....||.|.|:|.||.|               .:....|:.||:.. .:.|||.|||:   :.|
Zfish     1 MKAFILLALFAVAYAAPL---------------GDDDDKIVGGYECT-KNGVPYQVSLN---SGY 46

  Fly    67 THLCGASIIGKRWLLTAAHCVD-----ELRTFNGDAV-GTPVYAGIINRSNVTAAQVRYVDFAST 125
             |.||.|:|...|:::||||..     .|...|.|.. ||..:   ||...|    :|       
Zfish    47 -HFCGGSLISNLWVVSAAHCYKSRVQVRLGEHNIDVTEGTEQF---INSEKV----IR------- 96

  Fly   126 HRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGLTDPDGDEYSKELQ 190
            |.|:|.|...:::.|:.:|.|.:.|:.|:.::||. :...|..:....|||.....|..|...|.
Zfish    97 HPSYNSNTLDNDVMLIKLSSSAQINSYVKTVSLPS-SCASSGTSCLISGWGNMSASGSNYPSRLM 160

  Fly   191 YAFAPLLNSTGCKELLPADAPLTAQQVCSQV-----KTCYGDGGTPLIYWPITGPAELVGLGSWS 250
            ...||:|:.:.|:...|..  :::...|:..     .:|.||.|.|::.     ..:|.|:.||.
Zfish   161 CLNAPILSDSTCRNAYPGQ--ISSNMFCAGFMEGGKDSCQGDSGGPVVC-----NNQLQGIVSWG 218

  Fly   251 YMPCGYANRPTVYTSVPPYIGWIHQTIGA 279
            | .|...|:|.||..|..:..||..|:.:
Zfish   219 Y-GCAQRNKPGVYAKVCNFTTWIRNTMNS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 71/245 (29%)
Tryp_SPc 41..273 CDD:214473 69/242 (29%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 69/243 (28%)
Tryp_SPc 25..243 CDD:238113 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.