DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG18735

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:250 Identity:65/250 - (26%)
Similarity:107/250 - (42%) Gaps:38/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAG 105
            |:.|.:.: |...|:::.|......|   ||||::..::.|||||||      ||      .|..
  Fly    83 IVGGQETE-VHEYPWMIMLMWFGNFY---CGASLVNDQYALTAAHCV------NG------FYHR 131

  Fly   106 II-------NRSNVTAAQVRYVDFAST----HRSFNGNAGSDNIALLHVSESFEYNARVQQIALP 159
            :|       ||.:   :.|:.||...:    |..::......:|||:..:|.......:..:.:|
  Fly   132 LITVRLLEHNRQD---SHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP 193

  Fly   160 DINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQV--- 221
            ..:::|:.:||...|||... :|...|..||....|:|:...|:.....::.:|...:|:..   
  Fly   194 TPSENYAGQTAVVTGWGALS-EGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQ 257

  Fly   222 ---KTCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWI 273
               .:|.||.|.|:.........:|.|:.||. ..|...|.|.|||.|..:..||
  Fly   258 GGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWG-EGCAKPNAPGVYTRVGSFNDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 64/249 (26%)
Tryp_SPc 41..273 CDD:214473 63/248 (25%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 63/248 (25%)
Tryp_SPc 83..314 CDD:238113 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.