DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG34458

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:257 Identity:72/257 - (28%)
Similarity:113/257 - (43%) Gaps:37/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VHAEI----QPLIIDG-YDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRT 92
            ||:::    :..||.| :...|  ..|:.|||.|..   .|.||.|:|....::|||||.     
  Fly    20 VHSDMDVAEESRIIGGQFAAPG--QFPHQVSLQLNG---RHHCGGSLISDTMIVTAAHCT----- 74

  Fly    93 FNGDAVGTPVYAGIINRSNVTAAQVRYVDFAS--THRSFNGNAGSDNIALLHVSESFEYNARVQQ 155
             .|...|.  ...|:..::::|...:..:.|.  .|..:|..:...:::|:.:|........||.
  Fly    75 -MGQNPGQ--MKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQT 136

  Fly   156 IALPDINDDYSNKTAAAY-GWGLTDPDGDEYSKELQYAFAPLLNSTGC-KELLPADAPLTAQQVC 218
            |.|.|.:.:|:..|.|.. |:|..: ...:....|::|...|.:...| .:.:|.   ||.:.||
  Fly   137 IQLADSDSNYAADTMAMISGFGAIN-QNLQLPNRLKFAQVQLWSRDYCNSQNIPG---LTDRMVC 197

  Fly   219 S-----QVKTCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQ 275
            :     ||.:|.||.|.||     |...:|.|:.||.: .||...||.:||.|.....||.|
  Fly   198 AGHPSGQVSSCQGDSGGPL-----TVDGKLFGVVSWGF-GCGAKGRPAMYTYVGALRSWIKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 70/245 (29%)
Tryp_SPc 41..273 CDD:214473 67/241 (28%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 67/242 (28%)
Tryp_SPc 32..254 CDD:238113 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.