DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and KLK7

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_005037.1 Gene:KLK7 / 5650 HGNCID:6368 Length:253 Species:Homo sapiens


Alignment Length:291 Identity:74/291 - (25%)
Similarity:117/291 - (40%) Gaps:60/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSPLFLLPLLALAGAAKLPHIQHLTLRDTEQVHAEIQPLIIDGYDVQG---VDNVP-----YLV 57
            :|.||.:| ||:||                         |...|.:.||   :|..|     :..
Human     5 LLLPLQIL-LLSLA-------------------------LETAGEEAQGDKIIDGAPCARGSHPW 43

  Fly    58 SLSLTRATYTHLCGASIIGKRWLLTAAHC-VDELRTFNG-DAVGTPVYAGIINRSNVTAAQVRYV 120
            .::|......| ||..::.:||:|||||| ::|.....| |.:|.       .|:....|...: 
Human    44 QVALLSGNQLH-CGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGD-------RRAQRIKASKSF- 99

  Fly   121 DFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGLTDPDGDEY 185
                .|..::.....:::.|:.::.....::.|:::.||. ..:....|....|||.|......:
Human   100 ----RHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPS-RCEPPGTTCTVSGWGTTTSPDVTF 159

  Fly   186 SKELQYAFAPLLNSTGC----KELLPADAPLTAQQVCSQVKTCYGDGGTPLIYWPITGPAELVGL 246
            ..:|......|::...|    |:|| .::.|.|....|:...|.||.|.||:.     ...|.||
Human   160 PSDLMCVDVKLISPQDCTKVYKDLL-ENSMLCAGIPDSKKNACNGDSGGPLVC-----RGTLQGL 218

  Fly   247 GSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            .||...|||..|.|.|||.|..:..||:.|:
Human   219 VSWGTFPCGQPNDPGVYTQVCKFTKWINDTM 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 64/248 (26%)
Tryp_SPc 41..273 CDD:214473 62/245 (25%)
KLK7NP_005037.1 Tryp_SPc 29..245 CDD:214473 59/235 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.