DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and zmp:0000001114

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_685356.5 Gene:zmp:0000001114 / 557248 ZFINID:ZDB-GENE-140106-74 Length:841 Species:Danio rerio


Alignment Length:263 Identity:75/263 - (28%)
Similarity:114/263 - (43%) Gaps:39/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DGYDVQGVD--------------------NVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCV 87
            ||.|.||.|                    ..|:.|||..  .|..|.||||||..:|||.||||.
Zfish   584 DGSDEQGCDCGTRPYKHNRIVGGQNADVGEWPWQVSLHF--KTQGHACGASIISNKWLLCAAHCF 646

  Fly    88 ---DELRTFNGDAVGTPVYAGIINR-SNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFE 148
               |.........:   .|:|:.:: ::..:.|:|.:....||.::|......:|:||.:|:...
Zfish   647 IQPDPSYKMTSSWI---TYSGLRDQNTHDKSVQMRDLKTIITHPNYNDLTNDYDISLLELSQPLN 708

  Fly   149 YNARVQQIALPDINDDY-SNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPL 212
            ::..|..|.||..:..: :..:....||| |..:|...::.||.|...::|.|.|.  :..:..:
Zfish   709 FSNTVHPICLPATSHVFTAGSSCFVTGWG-TLREGGSAAQILQKAEVKVINDTVCN--MVTEGQV 770

  Fly   213 TAQQVCS-----QVKTCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGW 272
            |::.:||     .|..|.||.|.||:.....|.....|:.||. ..|...|:|.|||.|.....|
Zfish   771 TSRMMCSGYLSGGVDACQGDSGGPLVCLSEGGKWFQAGIVSWG-EGCARRNKPGVYTRVTKLREW 834

  Fly   273 IHQ 275
            |.:
Zfish   835 IRE 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 75/263 (29%)
Tryp_SPc 41..273 CDD:214473 73/259 (28%)
zmp:0000001114XP_685356.5 SEA 78..175 CDD:279699
CUB 208..322 CDD:238001
CUB 331..437 CDD:238001
LDLa 445..477 CDD:238060
LDLa 479..513 CDD:238060
LDLa 515..549 CDD:238060
LDLa 556..591 CDD:238060 4/6 (67%)
Tryp_SPc 602..835 CDD:214473 67/241 (28%)
Tryp_SPc 603..838 CDD:238113 69/244 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.