DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and zgc:100868

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:262 Identity:69/262 - (26%)
Similarity:110/262 - (41%) Gaps:42/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AEIQPLIIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVG 99
            |.:...|:.|.:.. |...|:.|||   :...:|.||.|:|..:|:||||||..     |....|
Zfish    31 APLNSRIVGGQNAP-VGAWPWQVSL---QRDGSHFCGGSLINNQWILTAAHCFP-----NPSTTG 86

  Fly   100 TPVYAGIINRSNVTA-AQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDIND 163
            ..||.|:...::..: :....|.....|.::|.:...::|.||.::.:..::..::.|.|...:.
Zfish    87 LLVYLGLQKLASFESYSMSSAVSNIIKHPNYNSDTEDNDITLLQLASTVSFSNYIRPICLAASDS 151

  Fly   164 DYSNKTAA-AYGWG-------LTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQ 220
            .:.|.|.. ..|||       |..|.      .||....|::.:..| ..|...:.:|...||:.
Zfish   152 TFFNGTLVWITGWGNTATGVSLPSPG------TLQEVQVPIVGNRKC-NCLYGVSKITDNMVCAG 209

  Fly   221 V-----KTCYGDGGTPLI-----YWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQ 275
            :     .:|.||.|.|::     .|..:|   :|..|:    .|...|.|.|||.|..|..||.|
Zfish   210 LLQGGKDSCQGDSGGPMVSKQGSVWIQSG---IVSFGT----GCAQPNFPGVYTRVSKYQSWIQQ 267

  Fly   276 TI 277
            .|
Zfish   268 RI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 66/253 (26%)
Tryp_SPc 41..273 CDD:214473 64/250 (26%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 64/251 (25%)
Tryp_SPc 37..267 CDD:238113 66/252 (26%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.