DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and prss60.2

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:244 Identity:73/244 - (29%)
Similarity:101/244 - (41%) Gaps:41/244 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYLVSLSLTRATY-THLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVTAAQV 117
            |:.|||...|  | .|.||.|:|...|:||||||:..:     ......||.|...:..|...:.
Zfish    46 PWQVSLQSPR--YGGHFCGGSLISSEWVLTAAHCLPGV-----SESSLVVYLGRRTQQGVNTHET 103

  Fly   118 -RYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAA-AYGWG---- 176
             |.|.....|.|:|.|...::||||.:|.:..:|..::.:.|...|..||..|:: ..|||    
Zfish   104 SRNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVCLAAQNSVYSAGTSSWITGWGDVQA 168

  Fly   177 ---LTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQV-----KTCYGDGGTPLI 233
               |..|.      .||....|::.:..|...| ....:|...:|:.:     .||.||.|.|::
Zfish   169 GVNLPAPG------ILQETMIPVVANDRCNAQL-GSGTVTNNMICAGLAKGGKDTCQGDSGGPMV 226

  Fly   234 -----YWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
                 .|      ...|:.||.| .|...|.|.|||.|..|..||...|
Zfish   227 TRLCTVW------IQAGITSWGY-GCADPNSPGVYTRVSQYQSWISSKI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 72/241 (30%)
Tryp_SPc 41..273 CDD:214473 70/238 (29%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 70/238 (29%)
Tryp_SPc 34..267 CDD:238113 72/241 (30%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.