Sequence 1: | NP_787956.1 | Gene: | CG33127 / 318893 | FlyBaseID: | FBgn0053127 | Length: | 284 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006230384.1 | Gene: | Prss53 / 499270 | RGDID: | 1566127 | Length: | 591 | Species: | Rattus norvegicus |
Alignment Length: | 271 | Identity: | 53/271 - (19%) |
---|---|---|---|
Similarity: | 97/271 - (35%) | Gaps: | 63/271 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 PYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVT-AAQV 117
Fly 118 RYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYS-NKTAAAYGWGLTDPD 181
Fly 182 GDEYS------------------------KELQYAFAPLLNSTGCKEL----------------- 205
Fly 206 ---LPADAPLTAQQVCSQVK-----TCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTV 262
Fly 263 YTSVPPYIGWI 273 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33127 | NP_787956.1 | Tryp_SPc | 41..276 | CDD:238113 | 53/271 (20%) |
Tryp_SPc | 41..273 | CDD:214473 | 52/269 (19%) | ||
Prss53 | XP_006230384.1 | Tryp_SPc | 45..310 | CDD:238113 | 53/271 (20%) |
Tryp_SPc | 341..561 | CDD:238113 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D433637at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |