DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Prss53

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:271 Identity:53/271 - (19%)
Similarity:97/271 - (35%) Gaps:63/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVT-AAQV 117
            |:..|:   |....|:|..|::...|:||||||.:::.|  .:.....|..|.:.:..:: .|:.
  Rat    49 PWQASV---RRQGVHICSGSLVADTWVLTAAHCFEKMAT--AELSSWSVVLGSLKQEGLSPGAEE 108

  Fly   118 RYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYS-NKTAAAYGWGLTDPD 181
            ..|......:::|..:...::|||.::....:..    :.||.....:. ..:..|.||.....|
  Rat   109 VGVAALQLPKAYNHYSQGSDLALLQLTHPIVHTT----LCLPQPTHHFPFGASCWATGWDQNTSD 169

  Fly   182 GDEYS------------------------KELQYAFAPLLNSTGCKEL----------------- 205
            | :|.                        .||....:||..|...:.|                 
  Rat   170 G-KYCPRHKSRESQTGSVLTVLALCSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCLYNRL 233

  Fly   206 ---LPADAPLTAQQVCSQVK-----TCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTV 262
               |.|: |..:..:|...:     .|.||.|.|::.....|....||:.|:: ..|...:.|.:
  Rat   234 HQRLLAN-PARSGMLCGGAQPGVQGPCQGDSGGPVMCREPDGHWVQVGIISFT-SNCAQEDTPVL 296

  Fly   263 YTSVPPYIGWI 273
            .|.:..:..|:
  Rat   297 LTDMAAHSSWL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 53/271 (20%)
Tryp_SPc 41..273 CDD:214473 52/269 (19%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 53/271 (20%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.