DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Prss36

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:306 Identity:84/306 - (27%)
Similarity:128/306 - (41%) Gaps:53/306 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLPLLALAGAAKLP-HIQHLTLRDTEQVHAEIQPL----------IIDGYDVQGVDNVPYLVSL 59
            ||.|.|..:..:..| ..|...:..|:   .|.:.|          |:.|.|.. ....|:.|||
  Rat    16 FLTPHLVFSVVSPTPGAFQDSAVSPTQ---GEFEDLDCGRPEPSSRIVGGSDAH-PGTWPWQVSL 76

  Fly    60 SLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNG---DAVGTPVYAGIINRSN-VTAAQVRYV 120
            .....   |:||.|:|...|:|:||||.    ..||   .|....|..|:.::.. :..|.:|.|
  Rat    77 HHGGG---HICGGSLIAPSWVLSAAHCF----VTNGTLEPADEWSVLLGVHSQDGPLEGAHMRSV 134

  Fly   121 DFASTHRSFNG-NAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAA-AYGWG-LTDPDG 182
            .......:::. ..|:| :|||.::...:....|:.:.||..:..:::.||. |.||| :.:.|.
  Rat   135 ATILVPDNYSRVELGAD-LALLRLASPAKLGPSVKPVCLPRASHLFAHGTACWATGWGDVQESDP 198

  Fly   183 DEYSKELQYAFAPLLNSTGCKELLPADAP--LTAQ----QVCS-----QVKTCYGDGGTPLI--- 233
            ......||.....||..|.|:.|.....|  ||.|    .:|:     :..||.||.|.||:   
  Rat   199 LPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGMLCAGYPEGRRDTCQGDSGGPLVCED 263

  Fly   234 --YWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
              .|      .|.|:.|:.: .||..|||.|:|:|..|..||.:.:
  Rat   264 GGRW------FLAGITSFGF-GCGRRNRPGVFTAVAHYESWIREHV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 75/257 (29%)
Tryp_SPc 41..273 CDD:214473 73/254 (29%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 75/257 (29%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.