DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and prss36

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001005710.1 Gene:prss36 / 448231 XenbaseID:XB-GENE-5892976 Length:719 Species:Xenopus tropicalis


Alignment Length:253 Identity:76/253 - (30%)
Similarity:117/253 - (46%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IIDGYDV-QGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYA 104
            |:.|.|. :|.  .|:.|||   |...:|:||.|:||.:|:||||||.:..: |..|   ..|..
 Frog   385 IVGGTDAREGA--WPWQVSL---RYRGSHICGGSVIGTQWILTAAHCFENSQ-FPSD---YEVRL 440

  Fly   105 GIINRSNVTAAQVRY-VDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNK 168
            |....:..:..::.| ||....:..|:.:....:|||:.::....|...:..:.||..::.:::.
 Frog   441 GTYRLAQTSPNEITYTVDRIIVNSQFDSSTLFGDIALIRLTSPITYTKYILPVCLPSTSNSFTDG 505

  Fly   169 TAA-AYGWGLTD-----PDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTA-------QQVCSQ 220
            ... ..|||...     |    |.|.||....||:|.|.|.::...|:|::|       .|:||.
 Frog   506 MECWVTGWGTISLYVNLP----YPKTLQEVMTPLINRTRCDQMYHIDSPVSASSEIIPSDQICSG 566

  Fly   221 VK-----TCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWI 273
            ..     :|.||.|.||: ..:.|....:|:.||. ..|..|.||.|||.||.|..|:
 Frog   567 YSAGGKDSCKGDSGGPLV-CKLQGIWYQIGIVSWG-EGCAIAKRPGVYTLVPAYYSWV 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 76/253 (30%)
Tryp_SPc 41..273 CDD:214473 75/251 (30%)
prss36NP_001005710.1 Tryp_SPc 37..276 CDD:238113
Tryp_SPc 385..622 CDD:238113 75/251 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.