DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG11313

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:239 Identity:64/239 - (26%)
Similarity:99/239 - (41%) Gaps:41/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TYTHLCGASIIGKRWLLTAAHCVD-ELRTFNGD-AVGTPVYAGIINRSNVT----------AAQV 117
            ||   |..|:|..|:::||||||. ..|...|| :....|..|..|.|.|.          ..|:
  Fly   145 TY---CAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQI 206

  Fly   118 RYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPD---INDDYSNKTAAAYGWGLT- 178
            . |:....|.||......::|||:.::....|:..::.:.||.   :.:..|.:.....|||.| 
  Fly   207 A-VEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTL 270

  Fly   179 DPDGDEYSKELQYAFA-PLLNSTGCKELLPADAPLTAQQVCSQVK----TCYGDGGTPLI----- 233
            ..:......:|:..:. |.|    |:....:...|....:|::.:    :|.||.|.||:     
  Fly   271 TSESSPVKMKLRVTYVEPGL----CRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEG 331

  Fly   234 YWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            .|.:.|   :|..|    :.||....|.|||:|..|..||.|.|
  Fly   332 VWVLGG---IVSFG----LNCGSRFWPAVYTNVLSYETWITQNI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 62/236 (26%)
Tryp_SPc 41..273 CDD:214473 60/233 (26%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 62/236 (26%)
Tryp_SPc 116..364 CDD:214473 60/233 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.