DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG9733

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:289 Identity:75/289 - (25%)
Similarity:113/289 - (39%) Gaps:74/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IQPLIIDGYDVQGVDNVPYLVSLSLTRATYTHL---CGASIIGKRWLLTAAHCVDELRTFNG--- 95
            |:..|.||.|.. |:..|::|.|...|.:...|   |..|:|.:|::||||||:      .|   
  Fly   158 IRNRIYDGQDTD-VNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCL------TGRIE 215

  Fly    96 DAVGTPVYAGIINRSNVTAA-----------QVRYVDFAS--THRSFNGNAGSD--NIALLHVSE 145
            ..|||.|...:......||.           :|:.:.|..  .|..::..|.:.  :|.|:.:..
  Fly   216 REVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMER 280

  Fly   146 SFEYNARVQQIALPD---INDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLP 207
            :..|:..:|.|.||.   :....|.:.....|||.|          |:.|.:.:........:.|
  Fly   281 NVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRT----------LKMARSAVKQKVTVNYVDP 335

  Fly   208 ADAPLTAQQVCSQVK-----------------TCYGDGGTPLI-----YWPITGPAELVGLGSWS 250
            |    ..:|..||:|                 :|.||.|.||:     .|      .|.|:.|:.
  Fly   336 A----KCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESW------VLEGIVSFG 390

  Fly   251 YMPCGYANRPTVYTSVPPYIGWIHQTIGA 279
            | .||..:.|.|||:|..|..||.|.:.|
  Fly   391 Y-KCGLKDWPGVYTNVAAYDIWIRQNVRA 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 72/280 (26%)
Tryp_SPc 41..273 CDD:214473 70/277 (25%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 70/278 (25%)
Tryp_SPc 162..415 CDD:238113 72/280 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.