DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and aqrs

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:285 Identity:60/285 - (21%)
Similarity:82/285 - (28%) Gaps:123/285 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LCGASIIGKRWLLTAAHC-------------VDELRTFNG----------DAVG--TPV------ 102
            :|..::|.:|.::|:.||             ...|....|          ..:|  .||      
  Fly    88 ICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDDNPEPHQVIGFFMPVNKNERF 152

  Fly   103 --YAGIINRSN-VTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFE---YNARVQQIAL--- 158
              |..::..|| :...:.||:..   ||. ...||.|.....:....|:   ||.||..|..   
  Fly   153 TNYVALLALSNKLDRDKYRYIPL---HRK-KPQAGDDVKMAYYGPPKFQIRLYNTRVMDIDRCKI 213

  Fly   159 --------------PDI----NDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKEL 205
                          ||.    |..:|.||..:     |.| ||           |||        
  Fly   214 HYGLKEVFHVSTFEPDFICVRNKRHSKKTTCS-----TRP-GD-----------PLL-------- 253

  Fly   206 LPADAPLTAQQVCSQVKTCYG------DGGTPL-IYWPITGPAELV-----------GLGSW--S 250
              .|..|.|..:       ||      |..|.: ||.||......:           |.|.:  |
  Fly   254 --IDNKLAAINI-------YGEHCDEDDDSTNMDIYLPIRPVIPFIQTATDALRAFTGSGPYNES 309

  Fly   251 Y-------MPCGYANRPTVYTSVPP 268
            |       :.......|.||...||
  Fly   310 YPTTLSPLLEAIVKKSPNVYVGGPP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 60/285 (21%)
Tryp_SPc 41..273 CDD:214473 60/285 (21%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 51/239 (21%)
Tryp_SPc 83..268 CDD:304450 45/217 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.