DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Tmprss9

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:247 Identity:78/247 - (31%)
Similarity:113/247 - (45%) Gaps:21/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GYDVQGVD----NVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYA 104
            |..|.||:    ..|:.|||   |..:.|.|||:|||.|||::||||.:|.:    |.......|
Mouse   454 GRIVGGVEAAPGEFPWQVSL---RENHEHFCGATIIGARWLVSAAHCFNEFQ----DPAQWAAQA 511

  Fly   105 GIINRSNVTAAQVR-YVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDY-SN 167
            |.::.|...|:.|| .|...:.|.:::.:....::|:|.::....:...||...||.....: ..
Mouse   512 GSVHLSGSEASAVRTRVLRIAKHPAYDADTADFDVAVLELARPLPFGRYVQPACLPAATHVFPPG 576

  Fly   168 KTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCS-----QVKTCYGD 227
            |.....|||....|.....:.||.|...||:.:.|..|.  ...||.:.||:     :|.:|.||
Mouse   577 KKCLISGWGYLKEDFLVKPEVLQKATVELLDQSLCSSLY--GHSLTDRMVCAGYLDGKVDSCQGD 639

  Fly   228 GGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTIGA 279
            .|.||:....:|...|.|:.||. :.|..|.||.|||.|.....||.:...|
Mouse   640 SGGPLVCEEPSGRFFLAGIVSWG-IGCAEARRPGVYTRVTRLRDWILEVTSA 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 77/242 (32%)
Tryp_SPc 41..273 CDD:214473 75/239 (31%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473 74/238 (31%)
Tryp_SPc 756..984 CDD:214473
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.