DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG11836

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:249 Identity:67/249 - (26%)
Similarity:113/249 - (45%) Gaps:46/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GVDNVPYLVSLSLTRATYT---HLCGASIIGKRWLLTAAHCVDEL-----RTFNGDAVGTPVYAG 105
            ||:..|:     :.|..|.   | ||.|::.|.::|:|||||.:|     |...||         
  Fly   104 GVNQYPW-----MARIVYDGKFH-CGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGD--------- 153

  Fly   106 IINRSNVTA---AQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSN 167
              :...:|:   |..|.|.....|:||:.:..:::||||.:.:...::..::.|.||..|.|.:.
  Fly   154 --HDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAG 216

  Fly   168 KTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCS---QVKTCYGDGG 229
            :.....|||.|. :|.|....:.....|:::.|.|:........:|:..:|:   .:.:|.||.|
  Fly   217 RIGTVVGWGRTS-EGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRPSMDSCQGDSG 280

  Fly   230 TPLI------YWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            .||:      |:       :||:.||. :.||....|.||:.|..:|.||...:
  Fly   281 GPLLLSNGVKYF-------IVGIVSWG-VGCGREGYPGVYSRVSKFIPWIKSNL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 67/246 (27%)
Tryp_SPc 41..273 CDD:214473 65/243 (27%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.