DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG12951

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:81/269 - (30%)
Similarity:115/269 - (42%) Gaps:63/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IIDGYDVQGVDNVPYLVSLSLTRATY--THLCGASIIGKRWLLTAAHCVDELRTFNGDAVGT-PV 102
            :::|.| ..|...|::|||    .:|  :|.||.|||.|.:::|||||.      ||....| .:
  Fly    30 VVNGTD-SSVLKYPFVVSL----RSYDGSHSCGGSIISKHFVMTAAHCT------NGRPADTLSI 83

  Fly   103 YAGIINRS----NVTAAQ--VRYVDFASTHRSFNGNAGSDNIALLHVSESFEYN-ARVQQIALPD 160
            ..|:.|.|    ||...:  :::.||..|.::.|      :|:||.|.|.||:: ..|..:.||.
  Fly    84 QFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNAN------DISLLMVEEPFEFDGVSVAPVELPA 142

  Fly   161 INDDYSNKTAAA----YGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQ------ 215
            :........|..    .||||.|..|         :....|.....|  :.:|...|::      
  Fly   143 LAFAVPQSDAGVEGVLIGWGLNDTYG---------SVQDTLQEVSLK--IYSDEECTSRHNGQTD 196

  Fly   216 ---QVCSQVK-----TCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGW 272
               .:|..|.     .|.||.|.||||     ..:.||:.|||..||..|..|.||..|..|:.|
  Fly   197 PKYHICGGVDEGGKGQCSGDSGGPLIY-----NGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256

  Fly   273 I--HQTIGA 279
            |  :|.|.|
  Fly   257 IKSNQIISA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 78/264 (30%)
Tryp_SPc 41..273 CDD:214473 76/259 (29%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 76/259 (29%)
Tryp_SPc 30..260 CDD:238113 78/262 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.