DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Sp7

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:236 Identity:67/236 - (28%)
Similarity:97/236 - (41%) Gaps:41/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CGASIIGKRWLLTAAHCV-DELRTFNGDAVGTPVYAGIINRS----------NVTAAQVRYVDFA 123
            ||.|:|..|::||||||| ..:.|..|..  |.|..|..:.|          |....|:. ::.|
  Fly   167 CGGSLINNRYVLTAAHCVIGAVETEVGHL--TTVRLGEYDTSKDVDCIDDICNQPILQLG-IEQA 228

  Fly   124 STHRSF---NGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTA---AAYGWGLTDPDG 182
            :.|..:   |.|...| ||||.:......|..:|.:.||.::...:..|.   ...|||.|....
  Fly   229 TVHPQYDPANKNRIHD-IALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTAR 292

  Fly   183 DEYSKELQYAFAPLLNSTGC-KELLPADAPLTAQQVCSQVK----TCYGDGGTPLI------YWP 236
            ....|  |....|:.:...| ::....:..|.:.|:|...:    :|.||.|.||:      .|.
  Fly   293 KSTIK--QRLDLPVNDHDYCARKFATRNIHLISSQLCVGGEFYRDSCDGDSGGPLMRRGFDQAWY 355

  Fly   237 ITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            ..|   :|..|:    .||....|.|||.|..|:.||.:||
  Fly   356 QEG---VVSFGN----RCGLEGWPGVYTRVADYMDWIVETI 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 65/233 (28%)
Tryp_SPc 41..273 CDD:214473 63/230 (27%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 63/230 (27%)
Tryp_SPc 137..388 CDD:238113 65/233 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.