DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG4914

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:244 Identity:74/244 - (30%)
Similarity:106/244 - (43%) Gaps:23/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGI 106
            |.|....||...|::..||.....|   ||.::|..|::|||||||.....|.     ..|..|.
  Fly   128 IVGGTTTGVSEYPWMARLSYFNRFY---CGGTLINDRYVLTAAHCVKGFMWFM-----IKVTFGE 184

  Fly   107 INRSN-VTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDI---NDDYSN 167
            .:|.| ....:.|:|..|.:.:....|..:| ||||.:::.....:.::.|.||.:   .|.:..
  Fly   185 HDRCNDKERPETRFVLRAFSQKFSFSNFDND-IALLRLNDRVPITSFIRPICLPRVEQRQDLFVG 248

  Fly   168 KTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGC-KELLPADAPLTAQQVCSQV------KTCY 225
            ..|.|.|||....|| :.|..||....|:|::..| .:.......:|...:||..      .:|.
  Fly   249 TKAIATGWGTLKEDG-KPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQ 312

  Fly   226 GDGGTPLI-YWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWI 273
            ||.|.||: ..|.....|.:|:.||. ..|...|.|.|||.|..|:.||
  Fly   313 GDSGGPLVRLRPDDKRFEQIGIVSWG-NGCARPNYPGVYTRVTKYLDWI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 74/244 (30%)
Tryp_SPc 41..273 CDD:214473 72/242 (30%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 72/242 (30%)
Tryp_SPc 128..363 CDD:238113 74/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.