DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG10663

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:230 Identity:59/230 - (25%)
Similarity:97/230 - (42%) Gaps:45/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGI----INRSNVTAAQVRYVDFASTHRSFN 130
            ||.::|..||:|||||||.::           ::..|    :|..:.|..|:|.:. :.||.:|:
  Fly   533 CGGTLIAPRWVLTAAHCVRKV-----------LFVRIGEHNLNYEDGTEIQLRVMK-SYTHPNFD 585

  Fly   131 GNAGSDNIALLHVSESFE------YNARVQQI-ALPDINDDYSNKTAAAYGWGL---TDPDGDEY 185
            ......::|||.:.::..      |:...|.. |||      .|......|||.   .|..|   
  Fly   586 KRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALP------KNVDCTIIGWGKRRNRDATG--- 641

  Fly   186 SKELQYAFAPLLNSTGCKELLPADAPLTAQQVCS-----QVKTCYGDGGTPLIYWPITGPAE--- 242
            :..|..|..|::....|:::. .|..:|....|:     .:.||.||.|.||:....|.|..   
  Fly   642 TSVLHKATVPIIPMQNCRKVY-YDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWT 705

  Fly   243 LVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            :.|:.|:. ..|...|:..:|..||.|:.|:...:
  Fly   706 IFGITSFG-DGCAQRNKFGIYAKVPNYVDWVWSVV 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 59/227 (26%)
Tryp_SPc 41..273 CDD:214473 58/224 (26%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 58/224 (26%)
Tryp_SPc 507..735 CDD:238113 58/224 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.