DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and ovch1

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_956439.2 Gene:ovch1 / 393114 ZFINID:ZDB-GENE-040426-834 Length:556 Species:Danio rerio


Alignment Length:239 Identity:59/239 - (24%)
Similarity:101/239 - (42%) Gaps:44/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYLVSLSLTRATYTHL--CGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVT--- 113
            |:.|||.     |..:  ||.:|:.:.|::||.||   .:.:...::...| .|:.|..|..   
Zfish    69 PWQVSLQ-----YNDVPTCGGAILDQLWVITAGHC---FKRYKKPSMWNAV-VGLHNLDNANESS 124

  Fly   114 --AAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSN-KTAAAYGW 175
              :.||:.:   .:|:::|.....::||||.:.....::..|:.|.:  .|:|... .|....||
Zfish   125 RESIQVQKI---FSHKNYNQKTNENDIALLKLQSPLVFSKFVRPIGV--FNNDLPPLVTCTVTGW 184

  Fly   176 GLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCS-----QVKTCYGDGGTPLI-- 233
            |....:|.:.|: ||.....:.....|....  ...:....:|:     .:..|.||.|.||.  
Zfish   185 GSVTENGPQASR-LQEVNVTVYEPQKCNRFY--RGKVLKSMICAGANEGGMDACQGDSGGPLSCF 246

  Fly   234 ----YWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWI 273
                |       :|.|:.||. :.||.|.:|.|||::..|..|:
Zfish   247 DGERY-------KLAGVVSWG-VGCGRAQKPGVYTTLYHYRQWM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 59/239 (25%)
Tryp_SPc 41..273 CDD:214473 58/237 (24%)
ovch1NP_956439.2 Tryp_SPc 56..281 CDD:214473 58/236 (25%)
Tryp_SPc 57..281 CDD:238113 58/236 (25%)
Tryp_SPc 331..551 CDD:238113
Tryp_SPc 331..549 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.