DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG14990

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:251 Identity:71/251 - (28%)
Similarity:107/251 - (42%) Gaps:37/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YDVQGVDNVPYLVSLSLTRATYTHLCGA-SIIGKRWLLTAAHCVDELRTFNGDAVGTP-----VY 103
            |...|  ..|::|:| .::..|   .|| |:|....:||||..|          ||..     |.
  Fly    66 YSTPG--QFPWVVAL-FSQGKY---FGAGSLIAPEVVLTAASIV----------VGKTDAEIVVR 114

  Fly   104 AGIIN---RSNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDY 165
            ||..|   ||....::.|.|.....||.|:...|::|||||.::..||..:.::.|.||.....:
  Fly   115 AGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSF 179

  Fly   166 SNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKE-----LLPADAPLTAQQVCS----QV 221
            ..|.....|||....:.:.||...:....|::|...|::     .|.....|.|..:|:    ..
  Fly   180 DQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDA 244

  Fly   222 KTCYGDGGTPLIYWPITGPA--ELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQ 275
            ..|.||||:.|.......|:  |..|:.:|. :.|...|.|.|||:|..:..||::
  Fly   245 GDCLGDGGSALFCPMEADPSRYEQAGIVNWG-IGCQEENVPAVYTNVEMFRDWIYE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 71/251 (28%)
Tryp_SPc 41..273 CDD:214473 69/247 (28%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 70/250 (28%)
Tryp_SPc 67..297 CDD:214473 68/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.