DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and KLK1

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:314 Identity:75/314 - (23%)
Similarity:114/314 - (36%) Gaps:100/314 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFLLPLLALAGAAKLPHIQHLTLRDTEQVHAEIQPLIIDGYDVQGVDNVPYLVSLSLTRATY--- 66
            |.|...|:|.|....|               .||..|:.|::.: ..:.|:..:|      |   
Human     4 LVLCLALSLGGTGAAP---------------PIQSRIVGGWECE-QHSQPWQAAL------YHFS 46

  Fly    67 THLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVTAAQVRYVDFASTHRSFNG 131
            |..||..::.::|:||||||:.:                            .|..:...|..|: 
Human    47 TFQCGGILVHRQWVLTAAHCISD----------------------------NYQLWLGRHNLFD- 82

  Fly   132 NAGSDNIA-LLHVSESFE---YNARVQQIALPDINDDYSN------------------------- 167
               .:|.| .:||||||.   :|..:.:......::|||:                         
Human    83 ---DENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPT 144

  Fly   168 ------KTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKEL---LPADAPLTAQQVCSQVKT 223
                  .|..|.|||..:|:...:..:||.....:|.:..||:.   ...|..|....:.....|
Human   145 EEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDT 209

  Fly   224 CYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            |.||.|.||:.     ...|.|:.||.|:|||..|:|:|...|..|:.||..||
Human   210 CVGDSGGPLMC-----DGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 65/275 (24%)
Tryp_SPc 41..273 CDD:214473 63/272 (23%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 65/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.