DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG30414

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:290 Identity:76/290 - (26%)
Similarity:111/290 - (38%) Gaps:79/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EIQPLIIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCV---------DELR 91
            |..|:|..|.|. |:.:.|::|     :.....|||.|:|..|::||||||:         .|.:
  Fly    36 EFIPMITGGADA-GLFSNPWMV-----KVLGEKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYK 94

  Fly    92 T-FNGDAVGTPVYAGI-INRSNVTAAQVRY--------------VDFASTHRSFNGNAGSDNIAL 140
            | |.|......|.... :.|..:.....|:              ||....|..:|.|..:| |.|
  Fly    95 TRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYNLNLDND-IGL 158

  Fly   141 LHVSESFEYNARVQQIAL---------PDINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPL 196
            |.:....:|:..|:.|.|         |..|         ..|||:|: ||.. |:.||.|....
  Fly   159 LRMKSFVQYSDYVRPICLLVEGHMAESPIFN---------ITGWGVTN-DGTP-SRRLQRATVYN 212

  Fly   197 LNSTGCKELLPADAPLTAQ----QVC---SQVKTCYGDGGTPLIYWPITGPAELVGLGSW---SY 251
            .:...|:      :..|.|    |:|   :....|:||.|.||       .|::...|||   .|
  Fly   213 TDLHFCR------SKFTKQVDESQICAAGTNSDACHGDSGGPL-------SAQVPFAGSWLTFQY 264

  Fly   252 MPCGYANRP----TVYTSVPPYIGWIHQTI 277
            ....|.:..    :|||:|..:..||...|
  Fly   265 GLVSYGSAACHSFSVYTNVTHHRDWIVNAI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 73/282 (26%)
Tryp_SPc 41..273 CDD:214473 71/279 (25%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 71/279 (25%)
Tryp_SPc 41..290 CDD:238113 71/279 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.