DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG9294

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:252 Identity:61/252 - (24%)
Similarity:105/252 - (41%) Gaps:37/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAG 105
            |:.|.:.: |...|::..:.:....|   |..|:|...::|||||||:          |.|....
  Fly   101 IVGGQETR-VHQYPWMAVILIYNRFY---CSGSLINDLYVLTAAHCVE----------GVPPELI 151

  Fly   106 II-----NR--SNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEY-NARVQQIALPDIN 162
            .:     ||  ||......|||.....|..:|..:..:::|:|.:::..:. :.|::.|.||..:
  Fly   152 TLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQS 216

  Fly   163 DDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKE---LLPADAPLTAQQVCSQV--- 221
            ..:.::.....||| ...:|...:..|:.....:|..:.|:.   ..|..  :|...:|:..   
  Fly   217 YSFDHELGIVAGWG-AQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQ--ITDNMMCAGYISE 278

  Fly   222 ---KTCYGDGGTPL--IYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWI 273
               ..|.||.|.||  .:....|..:|.|:.||. :.|.....|.|||.|..|:.|:
  Fly   279 GGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWG-VGCARPQSPGVYTRVNQYLRWL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 61/252 (24%)
Tryp_SPc 41..273 CDD:214473 60/250 (24%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 60/249 (24%)
Tryp_SPc 101..334 CDD:238113 60/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.