DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:266 Identity:80/266 - (30%)
Similarity:117/266 - (43%) Gaps:31/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HLTLRDTEQVHAEIQPLIIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVD 88
            |..|.|.....|.:..::  |....|....|:.|||.|.|.  .|.|||.::.:||||:||||.|
Human   845 HTQLPDCGLAPAALTRIV--GGSAAGRGEWPWQVSLWLRRR--EHRCGAVLVAERWLLSAAHCFD 905

  Fly    89 ELRTFNGDA------VGTPVYAGIINRSNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESF 147
                ..||.      :|||..:|       ...|:..|.....|..:|......::|||.::...
Human   906 ----VYGDPKQWAAFLGTPFLSG-------AEGQLERVARIYKHPFYNLYTLDYDVALLELAGPV 959

  Fly   148 EYNARVQQIALPDINDDYSNKTAAAY-GWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAP 211
            ..:..|:.|.||:......:.|.... ||| :..:|...:::||.|...||:...|:...|..  
Human   960 RRSRLVRPICLPEPAPRPPDGTRCVITGWG-SVREGGSMARQLQKAAVRLLSEQTCRRFYPVQ-- 1021

  Fly   212 LTAQQVCS-----QVKTCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIG 271
            ::::.:|:     .|.:|.||.|.||.....:|...|.|:.||.| .||..:.|.|||.|....|
Human  1022 ISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGY-GCGRPHFPGVYTRVAAVRG 1085

  Fly   272 WIHQTI 277
            ||.|.|
Human  1086 WIGQHI 1091

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 74/246 (30%)
Tryp_SPc 41..273 CDD:214473 72/243 (30%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.