DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and SPH93

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:225 Identity:62/225 - (27%)
Similarity:104/225 - (46%) Gaps:22/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAG---IINRSNVTAAQVRYVDFASTHRSF 129
            :|.|.|:|....:||.||.|..:.|   :.|   |.||   :.:...:..::.|.|:.|..|..|
  Fly   269 YLAGGSLIQPNVVLTVAHRVITIET---ELV---VRAGDWDLKSDREIFLSEQREVERAVIHEGF 327

  Fly   130 NGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFA 194
            :..:|::|:|||.::..|:.|..::.|.||..|..::.:.....|||....:...||..|:....
  Fly   328 DFKSGANNLALLFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQL 392

  Fly   195 PLLNSTGCKEL-----LPADAPLTAQQVCSQVK----TCYGDGGTPL---IYWPITGPAELVGLG 247
            .::|...|::.     |.|...|....:|:..:    ||.||||:.|   |....:|..|..|:.
  Fly   393 LVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIV 457

  Fly   248 SWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            :|. :.||....|.:||.|..:..||.:.:
  Fly   458 NWG-VGCGQEGIPAIYTEVSKFTNWITEKL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 62/222 (28%)
Tryp_SPc 41..273 CDD:214473 60/219 (27%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 62/222 (28%)
Tryp_SPc 252..482 CDD:214473 60/219 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.