DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG18478

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:222 Identity:62/222 - (27%)
Similarity:88/222 - (39%) Gaps:22/222 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVTAA---QVRYVDFASTHRSFNGN 132
            |.|:|....:|||||     |.||.|.....|.||.....:....   :..:|.....|:|||..
  Fly    70 GGSLITPDIVLTAAH-----RIFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQ 129

  Fly   133 AGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLL 197
            .|::|:|||.:...|....::..|.||......|:......|||........|...|:....|::
  Fly   130 RGANNLALLFLDREFPLTYKINTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIV 194

  Fly   198 NSTGC-----KELLPADAPLTAQQVCS----QVKTCYGDGGTPLIYWPITGPA---ELVGLGSWS 250
            ....|     |..|..:..|....:|:    ....|.||||..| :.|:|...   |.:|:.:|.
  Fly   195 PRHICQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGAL-FCPMTEDPKQFEQIGIVNWG 258

  Fly   251 YMPCGYANRPTVYTSVPPYIGWIHQTI 277
             :.|...|.|..||.|..:..||.|.|
  Fly   259 -VGCKEKNVPATYTDVFEFKPWIVQQI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 60/219 (27%)
Tryp_SPc 41..273 CDD:214473 58/216 (27%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 60/219 (27%)
Tryp_SPc 50..280 CDD:214473 58/216 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.