DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:223 Identity:63/223 - (28%)
Similarity:98/223 - (43%) Gaps:24/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVTAAQVRYVD----FASTHRSFN 130
            ||.|:|....:|||||||..:.::  |......:.|..|..  |..:|::|.    ....|:.|.
  Fly   425 CGGSLITNSHILTAAHCVARMTSW--DVAALTAHLGDYNIG--TDFEVQHVSRRIKRLVRHKGFE 485

  Fly   131 GNAGSDNIALLHVSESFEYNARVQQIALP----DINDDYSNKTAAAYGWGLTDPDGDEYSKELQY 191
            .:...:::|:|.:||...:...:|.|.||    ..:..||.:.|...|||....:|.:.| .||.
  Fly   486 FSTLHNDVAILTLSEPVPFTREIQPICLPTSPSQQSRSYSGQVATVAGWGSLRENGPQPS-ILQK 549

  Fly   192 AFAPLLNSTGCKELLPADAP--LTAQQVC---SQVKTCYGDGGTPLIYWPIT--GPAELVGLGSW 249
            ...|:..:..|.......||  :....:|   :...:|.||.|.|::   |.  |....||:.||
  Fly   550 VDIPIWTNAECARKYGRAAPGGIIESMICAGQAAKDSCSGDSGGPMV---INDGGRYTQVGIVSW 611

  Fly   250 SYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            . :.||....|.|||.|...:.||::.|
  Fly   612 G-IGCGKGQYPGVYTRVTSLLPWIYKNI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 62/220 (28%)
Tryp_SPc 41..273 CDD:214473 60/217 (28%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 60/217 (28%)
Tryp_SPc 400..637 CDD:238113 62/220 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.