DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and TMPRSS7

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:271 Identity:75/271 - (27%)
Similarity:120/271 - (44%) Gaps:50/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RDTEQVHAEIQPLIIDGYD-VQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELR 91
            |.:..:|.     ||.|.| ::|  ..|:.|||....:.|   ||||:|.:.|||:||||     
Human   598 RSSSALHR-----IIGGTDTLEG--GWPWQVSLHFVGSAY---CGASVISREWLLSAAHC----- 647

  Fly    92 TFNGDAVGTP----VYAGIINRSNVT-AAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNA 151
             |:|:.:..|    .:.|:..:.|.. .:.||.:   ..|..:|......:||||.:|.::....
Human   648 -FHGNRLSDPTPWTAHLGMYVQGNAKFVSPVRRI---VVHEYYNSQTFDYDIALLQLSIAWPETL 708

  Fly   152 R--VQQIALPDINDDY-SNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLT 213
            :  :|.|.:|...... |.:.....|||......::.|..||.|...|::.|.|   :.....:|
Human   709 KQLIQPICIPPTGQRVRSGEKCWVTGWGRRHEADNKGSLVLQQAEVELIDQTLC---VSTYGIIT 770

  Fly   214 AQQVCSQVKT-----CYGDGGTPLI-------YWPITGPAELVGLGSWSYMPCGYANRPTVYTSV 266
            ::.:|:.:.:     |.||.|.||.       .|.:|      |:.||.: ..|..|.|.|||.|
Human   771 SRMLCAGIMSGKRDACKGDSGGPLSCRRKSDGKWILT------GIVSWGH-GSGRPNFPGVYTRV 828

  Fly   267 PPYIGWIHQTI 277
            ..::.|||:.:
Human   829 SNFVPWIHKYV 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 73/255 (29%)
Tryp_SPc 41..273 CDD:214473 70/252 (28%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.