DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and PRSS53

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:343 Identity:71/343 - (20%)
Similarity:118/343 - (34%) Gaps:95/343 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PLLALAGAAKLPHIQHLTLRDTEQVHAEIQPLIIDGYDVQGVDNVPYLVSLSLTRATYTHLCGAS 73
            |:|.:|||..|........|...| .....|...:|..|.|  ..|:..|:   |....|:|..|
Human     7 PVLLIAGATVLMEGLQAAQRACGQ-RGPGPPKPQEGNTVPG--EWPWQASV---RRQGAHICSGS 65

  Fly    74 IIGKRWLLTAAHCVD-----ELRTFNGDAVGTPVYAGIINRSNVT-AAQVRYVDFASTHRSFNGN 132
            ::...|:||||||.:     ||.:::       |..|.:.|..:: .|:...|......|::|..
Human    66 LVADTWVLTAAHCFEKAAATELNSWS-------VVLGSLQREGLSPGAEEVGVAALQLPRAYNHY 123

  Fly   133 AGSDNIALLHVSESFEYNARVQQIALPDINDDYS-NKTAAAYGWGLTDPDGDEYSKELQYAFAPL 196
            :...::|||.::....:.    .:.||.....:. ..:..|.||.....||..:.: |:...|..
Human   124 SQGSDLALLQLAHPTTHT----PLCLPQPAHRFPFGASCWATGWDQDTSDGKCWPR-LKLGEALC 183

  Fly   197 LNST-----GC----KELLP-----ADAP---------------LTAQQVCSQVKT--------- 223
            |.|.     .|    ..|||     |.||               |.::..|:.:..         
Human   184 LPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIYNQLHQRHLSN 248

  Fly   224 ------------------CYGDGGTPLI------YWPITGPAELVGLGSWSYMPCGYANRPTVYT 264
                              |.||.|.|::      :|...|   ::...|    .|...:.|.:.|
Human   249 PARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAG---IISFAS----SCAQEDAPVLLT 306

  Fly   265 SVPPYIGWIHQTI-GAYY 281
            :...:..|:...: ||.:
Human   307 NTAAHSSWLQARVQGAAF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 60/303 (20%)
Tryp_SPc 41..273 CDD:214473 59/300 (20%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 59/297 (20%)
Tryp_SPc 43..314 CDD:214473 58/294 (20%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.