DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG18557

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:249 Identity:69/249 - (27%)
Similarity:108/249 - (43%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYLVSLSLTRATYTHLCGA-SIIGKRWLLTAAHCVDELRTFN-----GDAVGTPVYAGIINRSNV 112
            |:.|:|   .....:..|| :::.:..::||||.:.: :|.|     |.|......||       
  Fly    96 PWTVAL---MQNLINFFGAGTLVTENIVITAAHLMLD-KTINDFGIIGGAWDLKQLAG------- 149

  Fly   113 TAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGL 177
            ...|.|......:|..||...|::||||:.:..||.....:..|..|.....:..:.....|||.
  Fly   150 KTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVAGWGR 214

  Fly   178 TDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQV---------KTCYGDGGTPLI 233
            .|.....||.:.:....|:::.:.|:.||...|.:.:.|:...:         ..|.||||:||:
  Fly   215 PDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLM 279

  Fly   234 YWPITG-PA--ELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTIGAYYQLN 284
             .||.| ||  ||||:.: |...||..|.|.:||::.....||.:      |||
  Fly   280 -CPIPGHPAIYELVGIVN-SGFSCGLENVPALYTNISHMRPWIEK------QLN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 66/239 (28%)
Tryp_SPc 41..273 CDD:214473 64/236 (27%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 66/245 (27%)
Tryp_SPc 90..320 CDD:214473 64/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.