DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG11911

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:295 Identity:108/295 - (36%)
Similarity:156/295 - (52%) Gaps:33/295 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSPLFLLPLLALAGAAKLPHIQHLTLRDTEQVHAEIQPLIIDGYDVQGVD----NVPYLVSLSL 61
            :::...::.|:|.|..|||          :::: |::.|....|:.:.|.:    :.||:|||:.
  Fly     3 LITVTLVIALVAAAQGAKL----------SDKL-AKLVPSFATGFVINGTEAEPHSAPYIVSLAT 56

  Fly    62 TRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNV-TAAQVRYVDFAST 125
            ....::|:||.::|.|.|::|||||:.|       .||..:.||:..|:.| ...|.|.|||...
  Fly    57 NYLKHSHICGGTLINKDWIVTAAHCISE-------PVGMSIIAGLHTRAEVDELTQQRQVDFGRV 114

  Fly   126 HRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGLTDPDGDEYS--KE 188
            |..:.|..|..:||||||:|||.:|..||...||.....:..:| ..||||  .|....:|  |.
  Fly   115 HEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGET-HLYGWG--QPKSYIFSGAKT 176

  Fly   189 LQYAFAPLLNSTGCKELLPADAPLTAQQVCS----QVKT-CYGDGGTPLIYWPITGPAELVGLGS 248
            ||.....:||...|||.||..||:....:||    |.|: |.||.|.||:......|:||:|:.|
  Fly   177 LQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVS 241

  Fly   249 WSYMPCGYANRPTVYTSVPPYIGWIHQTIGAYYQL 283
            |.|:|||.||.|::||.|..||.||.....|||:|
  Fly   242 WGYIPCGLANMPSIYTKVSAYIDWITNIQSAYYKL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 96/246 (39%)
Tryp_SPc 41..273 CDD:214473 94/243 (39%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 95/241 (39%)
Tryp_SPc 37..266 CDD:214473 93/238 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQSN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D36714at33392
OrthoFinder 1 1.000 - - FOG0016932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.