DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG14227

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:246 Identity:57/246 - (23%)
Similarity:94/246 - (38%) Gaps:51/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCV--DELRTFNGDAVGTPVYAGIINRSNVTAAQ 116
            |::||:.:....   .|..|:|..|::|||||||  :.::...||...........:.:.::.|.
  Fly    57 PWIVSVIVNGKA---KCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAY 118

  Fly   117 VRYVDFASTHRSFNG-NAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYG------ 174
            ...:|....|..|.. .|...:|.||.:..:.:|:..|:.|.|      ..|:..||..      
  Fly   119 CVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICL------LINEPVAAIDRFQLTV 177

  Fly   175 WGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQVKT---CYGDGGTP----L 232
            ||.|..|.....:.|:::....::...|  .|.....:...|:|...:|   |.||.|.|    :
  Fly   178 WGTTAEDFRSIPRVLKHSVGDRIDRELC--TLKFQQQVDESQICVHTETSHACKGDSGGPFSAKI 240

  Fly   233 IYWP----------ITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWI 273
            :|..          |.|.:...||              :|.|:|..|:.||
  Fly   241 LYGGTYRTFQFGIIIFGLSSCAGL--------------SVCTNVTFYMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 57/246 (23%)
Tryp_SPc 41..273 CDD:214473 55/244 (23%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 55/244 (23%)
Tryp_SPc 57..277 CDD:238113 55/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.