DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Tmprss6

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:235 Identity:64/235 - (27%)
Similarity:104/235 - (44%) Gaps:24/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTP----VYAGIINRSNVTA 114
            |:..||.:..   .|:||.::|..||::|||||      |..|::.:|    |:.|.:.:::...
  Rat   589 PWQASLQIRG---RHICGGALIADRWVITAAHC------FQEDSMASPRLWTVFLGKMRQNSRWP 644

  Fly   115 AQVRY-VDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYS-NKTAAAYGWGL 177
            .:|.: |.....|.....::...::|||.:.....|:|.|:.:.||..:..:. .:.....||| 
  Rat   645 GEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSATVRPVCLPARSHFFEPGQHCWITGWG- 708

  Fly   178 TDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQVK-----TCYGDGGTPLIYWPI 237
            ...:|...|..||.....|:....|.|.....  :|.:.:|:..:     .|.||.|.||:....
  Rat   709 AQREGGPGSSTLQKVDVQLIPQDLCNEAYRYQ--VTPRMLCAGYRKGKKDACQGDSGGPLVCKEP 771

  Fly   238 TGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            :|...|.||.||. :.||..|...|||.|...:.||.|.:
  Rat   772 SGRWFLAGLVSWG-LGCGRPNFFGVYTRVTRVVNWIQQVL 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 63/232 (27%)
Tryp_SPc 41..273 CDD:214473 61/229 (27%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 61/229 (27%)
Tryp_SPc 577..809 CDD:238113 63/232 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.