DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Klk14

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:288 Identity:72/288 - (25%)
Similarity:108/288 - (37%) Gaps:52/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSPLFLLPLLALAGAAKLPHIQHLTLRDTEQVHAEIQPLIIDGYD-VQGVDNVPYLVSLSLTRA 64
            ||..|.:|..||:|                 .|.::....|:.||. ||  ::.|:.|:|.....
  Rat    61 MLLLLTILQALAVA-----------------IVQSQGDDKILGGYTCVQ--NSQPWQVALQAGPG 106

  Fly    65 TYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNV----TAAQVRYVDFAST 125
            . ..|||..::..:|::|||||            ..|:....:.:.|:    ...||..|.....
  Rat   107 R-RFLCGGVLLSDQWVITAAHC------------ARPLLHVALGKHNLRRWEATQQVLRVVRQVP 158

  Fly   126 HRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKT-AAAYGWGLTDPDGDEYSKEL 189
            |..:...|..:::.||.:.........|:.|  |......|..| ....|||.|......|...|
  Rat   159 HPQYRPQAHDNDLMLLKLQRKVRLGRAVRTI--PVARSCASPGTPCRVSGWGTTASPIVRYPTAL 221

  Fly   190 QYAFAPLLNSTGCKELLPADAPLTAQQVCSQV-----KTCYGDGGTPLIYWPITGPAELVGLGSW 249
            |.....::....|....|  ..:|:..||:.|     .:|.||.|.||:.     ..:|.||.||
  Rat   222 QCVNVNIMPEQVCHRAYP--GTITSGMVCAGVPEGGKDSCQGDSGGPLVC-----QGQLQGLVSW 279

  Fly   250 SYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            ....|.....|.|||::..|..||.:|:
  Rat   280 GMERCAMPGYPGVYTNLCNYHSWIQRTM 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 63/245 (26%)
Tryp_SPc 41..273 CDD:214473 61/242 (25%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 63/245 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.