DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Tmprss11e

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_038948843.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:444 Species:Rattus norvegicus


Alignment Length:220 Identity:57/220 - (25%)
Similarity:96/220 - (43%) Gaps:19/220 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 THLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVTAAQVRYVDFASTHRSFNG 131
            :|.|||::|...||::||||   .||....:..|..:...:....:|....|.:    .|..:|.
  Rat   235 SHRCGATLISNTWLVSAAHC---FRTHKDPSRWTASFGATLQPPKLTTGIRRII----VHEKYNY 292

  Fly   132 NAGSDNIALLHVSESFEYNARVQQIALPDINDDYS-NKTAAAYGWGLTDPDG--DEYSKELQYAF 193
            .:...:|||:.:|........|.::.|||.|.::. .:.....|:|....||  ..|.:::|..:
  Rat   293 PSHDYDIALVELSRPVPCTNAVHKVCLPDANHEFQPGQRMFVTGFGALRNDGFAQNYLRQVQVDY 357

  Fly   194 APLLNSTGCKELLPADAPLTAQQVCS-----QVKTCYGDGGTPLIYWPITGPAELVGLGSWSYMP 253
               :::..|......:..:|.:.:|:     :...|.||.|.||:...:.....|.|:.||. ..
  Rat   358 ---IDTQTCNRPQSYNGAITPRMLCAGFLKGEKDACQGDSGGPLVTPDVRDVWYLAGVVSWG-DE 418

  Fly   254 CGYANRPTVYTSVPPYIGWIHQTIG 278
            ||..|:|.|||.|..:..||....|
  Rat   419 CGQPNKPGVYTRVTAFRDWITSNTG 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 56/216 (26%)
Tryp_SPc 41..273 CDD:214473 54/213 (25%)
Tmprss11eXP_038948843.1 SEA 71..176 CDD:396113
Tryp_SPc 213..441 CDD:238113 56/216 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.