DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG33226

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:297 Identity:77/297 - (25%)
Similarity:119/297 - (40%) Gaps:57/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLALAGAAKLPHIQHLTLRDTEQVHAEIQPLIIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASI 74
            :|||.....|.  |.|...:..|....::..|:.|::.. :...|::|.: |.|.  .|.||.|:
  Fly    18 ILALRSYESLG--QDLLDPNCVQTPVGVREQILGGHNAD-IKLHPWMVQI-LQRG--YHFCGGSL 76

  Fly    75 IGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVTA---------AQVRYVDFASTHRSFN 130
            |...::||||||....|.    .|....|:||..|...::         ..|:.:...|::|.::
  Fly    77 ISSLFVLTAAHCHSRYRL----KVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYH 137

  Fly   131 GNAGSDNIALLHVSESFEYNARVQQI-ALPDINDD----YSNKTAA--AYGWGLTDPDGDEYSKE 188
                :.:|||..:::...||.:.:.| .|...|.|    :.|..|.  ..|||.|  :....|..
  Fly   138 ----NYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKT--ESQLTSTI 196

  Fly   189 LQYAFAPLLNSTGCKELLPADAPLTAQQVC---SQVKTCYGDGGTPLIYWPITGPAELV------ 244
            ||......|:...|.::.  |..:....:|   ||..||.||.|.||       .|||.      
  Fly   197 LQTTSLFHLDRKFCAQIF--DRKIGWPHICAGHSQSSTCTGDSGGPL-------SAELTFSGVKR 252

  Fly   245 ----GLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
                |:.|:....|   ...||:|:|..|..||...:
  Fly   253 TVLFGIISYGAPNC---REVTVFTNVLRYSNWIRDIV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 70/263 (27%)
Tryp_SPc 41..273 CDD:214473 68/260 (26%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 70/263 (27%)
Tryp_SPc 47..282 CDD:214473 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.