DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Tmprss5

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:216 Identity:65/216 - (30%)
Similarity:96/216 - (44%) Gaps:10/216 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVTAAQVRYVDFASTHRSFNGN 132
            |.||||::...|::|||||:...|.  .......|:||:::.|.|...|...|:....|..::..
  Rat   231 HTCGASVLAPYWVVTAAHCMYSFRL--SRLSSWRVHAGLVSHSAVRQHQGTMVEKIIPHPLYSAQ 293

  Fly   133 AGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAA-AYGWGLTDPDGDEYSKELQYAFAPL 196
            ....::|||.:.....::..|..:.||.....:...:.. ..|||.|||.....|..||....||
  Rat   294 NHDYDVALLQLRTPINFSDTVSAVCLPAKEQHFPQGSQCWVSGWGHTDPSHTHSSDTLQDTMVPL 358

  Fly   197 LNSTGCKELLPADAPLTAQQVCS-----QVKTCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGY 256
            |::..|.........||.:.:|:     :...|.||.|.||: .|......|||:.||. ..|..
  Rat   359 LSTDLCNSSCMYSGALTHRMLCAGYLDGRADACQGDSGGPLV-CPSGDTWHLVGVVSWG-RGCAE 421

  Fly   257 ANRPTVYTSVPPYIGWIHQTI 277
            .|||.||..|..::.|||.|:
  Rat   422 PNRPGVYAKVAEFLDWIHDTV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 64/213 (30%)
Tryp_SPc 41..273 CDD:214473 61/210 (29%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055
Tryp_SPc 208..441 CDD:238113 64/213 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.