DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and KLK13

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:222 Identity:70/222 - (31%)
Similarity:95/222 - (42%) Gaps:26/222 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVTAA-QVRYVDFASTHRSFNGN 132
            |||..::..:|:||||||:.|         |..||.|......|.|. |||.|..:..|..:..:
Human    60 LCGGVLVHPKWVLTAAHCLKE---------GLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRS 115

  Fly   133 AGSDN----IALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAF 193
            ....|    |.||.:....:....:|.:.|...|......|....|||.|......|.|.||.|.
Human   116 PTHLNHDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTPGTTCRVSGWGTTTSPQVNYPKTLQCAN 180

  Fly   194 APLLNSTGCKELLPADAPLTAQQVCSQVK-----TCYGDGGTPLIYWPITGPAELVGLGSWSYMP 253
            ..|.:...|:::.|  ..:|...:|:..|     :|.||.|.||:.     ...|.|:.||...|
Human   181 IQLRSDEECRQVYP--GKITDNMLCAGTKEGGKDSCEGDSGGPLVC-----NRTLYGIVSWGDFP 238

  Fly   254 CGYANRPTVYTSVPPYIGWIHQTIGAY 280
            ||..:||.|||.|..|:.||.:||..|
Human   239 CGQPDRPGVYTRVSRYVLWIRETIRKY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 67/216 (31%)
Tryp_SPc 41..273 CDD:214473 65/213 (31%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 67/216 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.