DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Klk1c2

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:258 Identity:69/258 - (26%)
Similarity:106/258 - (41%) Gaps:42/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QPLIIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPV 102
            |..|:.||..: .::.|:.|::     ...:|||..:|...|::|||||...            .
  Rat    22 QSRIVGGYKCE-KNSQPWQVAV-----INEYLCGGVLIDPSWVITAAHCYSN------------N 68

  Fly   103 YAGIINRSNV----TAAQVRYVDFASTHRSF------NG-----NAGSDNIALLHVSESFEYNAR 152
            |..::.|:|:    ..||.|.|..:..|..:      |.     :..|:::.|||:||..:....
  Rat    69 YQVLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGG 133

  Fly   153 VQQIALPDINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLP---ADAPLTA 214
            |:.|.|| ..:.....|..|.|||.|:|.....|.:||.....||::..|.|...   .|..|.|
  Rat   134 VKVIDLP-TKEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKCIETYKDNVTDVMLCA 197

  Fly   215 QQVCSQVKTCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            .::.....||.||.|.|||.     ...|.|:.|....||.....|.:|..:..:..||.:.:
  Rat   198 GEMEGGKDTCAGDSGGPLIC-----DGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVM 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 68/252 (27%)
Tryp_SPc 41..273 CDD:214473 66/249 (27%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 66/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.