DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG30288

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:266 Identity:68/266 - (25%)
Similarity:104/266 - (39%) Gaps:64/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGI 106
            |||....|:::.|::|.:.::...   :||.|:|..|::|||.||:            :|:|..:
  Fly    43 IDGGRDAGMESNPWMVRVMISGKA---VCGGSLITARFVLTAEHCI------------SPMYMNV 92

  Fly   107 INRSNVTAAQVRYV-----DFASTHRSFN---------GNAGSDNIALLHVSESFEYNARVQQIA 157
                .:.....|:.     ||..|.|::|         .|.|.| |.||.:..|..::..|:.|.
  Fly    93 ----RLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPGYD-IGLLRMQRSVIFSNYVRPIC 152

  Fly   158 LPDINDDYSNKTAAA----------YGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPL 212
            |      ...||...          .||| |:.||:|..: ||.|....|....|:.   ...||
  Fly   153 L------ILGKTLGGNPLSILRFNFTGWG-TNSDGEEQDR-LQTATLQQLPQWSCER---PGRPL 206

  Fly   213 TAQQVC--SQVK-TCYGDGGTPLI---YWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIG 271
            ....:|  |.:. :|.||.|.||.   .:...|.....|:.|.....|....   :||:|..:..
  Fly   207 DISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGLG---IYTNVTHFTD 268

  Fly   272 WIHQTI 277
            ||...|
  Fly   269 WILDVI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 67/263 (25%)
Tryp_SPc 41..273 CDD:214473 65/260 (25%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 65/260 (25%)
Tryp_SPc 45..270 CDD:238113 63/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.