DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG30082

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:227 Identity:66/227 - (29%)
Similarity:94/227 - (41%) Gaps:30/227 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YTH-----LCGASIIGKRWLLTAAHCVD--ELRTFNGDAVGTPVYAGIINRSNVTAAQVRYVDFA 123
            |.|     :|..::|.||::||||||:.  .|.|.......|.......:...:...:...|:.|
  Fly    56 YLHKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENA 120

  Fly   124 STHRSFNGNAGSDN-IALLHVSESFEYNARVQQIALPDIND----DYSNKTAAAYGWGLTDPDGD 183
            ..|..|.|...|.| |.||.::.:..|...::.|.|  ..|    .||: |..|.|||..|....
  Fly   121 YIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICL--FRDPGQVPYSS-TYEAAGWGKIDLINT 182

  Fly   184 EYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCS---QVKTCYGDGGTPL----IYWPITGPA 241
              :..||......|:.:.|:..|...  |:..|.|:   :..||.||.|.||    ....||...
  Fly   183 --ATVLQTVNLIRLDQSDCERSLRTS--LSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTV 243

  Fly   242 ELVGLGSWSYMPCGYANRPTVYTSVPPYIGWI 273
            :| |:.|:.:..|   ..|.|||.||.:..||
  Fly   244 QL-GIVSYGHYLC---RGPGVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 66/227 (29%)
Tryp_SPc 41..273 CDD:214473 64/225 (28%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 64/225 (28%)
Tryp_SPc 40..274 CDD:238113 66/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.