DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Klk1

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_036725.1 Gene:Klk1 / 24523 RGDID:2969 Length:261 Species:Rattus norvegicus


Alignment Length:260 Identity:74/260 - (28%)
Similarity:115/260 - (44%) Gaps:44/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QPLIIDGYDVQGVDNVPYLVSL-SLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTP 101
            |..:|.||..: .::.|:.|:| |.|:    :|||..:|...|::|||||            .:.
  Rat    22 QSRVIGGYKCE-KNSQPWQVALYSFTK----YLCGGVLIDPSWVITAAHC------------SSN 69

  Fly   102 VYAGIINRSNVTA----AQVRYVDFASTHRSFN-----------GNAGSDNIALLHVSESFEYNA 151
            .|...:.|:|:..    ||.|.|..:..|..:.           |:..|:::.|||:|:..:...
  Rat    70 NYQVWLGRNNLLEDEPFAQHRLVSQSFPHPDYKPFLMRNHTRKPGDDHSNDLMLLHLSQPADITD 134

  Fly   152 RVQQIALPDINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGC----KELLPADAPL 212
            .|:.|.|| ..:.....|..|.|||.|.|...|:..:||.....||::..|    ||.: .|..|
  Rat   135 GVKVIDLP-TEEPKVGSTCLASGWGSTKPLIWEFPDDLQCVNIHLLSNEKCIKAYKEKV-TDLML 197

  Fly   213 TAQQVCSQVKTCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            .|.::.....||.||.|.||:.     ...|.|:.||..:||...|.|.:||.:..:..||.:.:
  Rat   198 CAGELEGGKDTCTGDSGGPLLC-----DGVLQGITSWGSVPCAKTNMPAIYTKLIKFTSWIKEVM 257

  Fly   278  277
              Rat   258  257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 73/254 (29%)
Tryp_SPc 41..273 CDD:214473 71/251 (28%)
Klk1NP_036725.1 Tryp_SPc 24..253 CDD:214473 71/252 (28%)
Tryp_SPc 25..256 CDD:238113 73/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.