DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Klk6

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001158168.1 Gene:Klk6 / 19144 MGIID:1343166 Length:253 Species:Mus musculus


Alignment Length:240 Identity:69/240 - (28%)
Similarity:104/240 - (43%) Gaps:42/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DNVPYLVSLSLTRATYTH---LCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNV 112
            |:.|:..:|      ||.   |||..:|..:|:||||||            ..|....|:.:.|:
Mouse    38 DSHPFQAAL------YTSGHLLCGGVLIDPQWVLTAAHC------------KKPNLQVILGKHNL 84

  Fly   113 ----TAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDIND-DYSNKTAAA 172
                |..:...||....|..:|.....::|.::|:....:::.::|  .||..|| ...|.....
Mouse    85 RQTETFQRQISVDRTIVHPRYNPETHDNDIMMVHLKNPVKFSKKIQ--PLPLKNDCSEENPNCQI 147

  Fly   173 YGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCS-QVK----TCYGDGGTPL 232
            .|||..: :|| :...:|.|...|:....|:...|  ..:|...||: .:|    :|.||.|.||
Mouse   148 LGWGKME-NGD-FPDTIQCADVHLVPREQCERAYP--GKITQSMVCAGDMKEGNDSCQGDSGGPL 208

  Fly   233 IYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            :.     ...|.||.||..||||...:|.|||.|..:|.||...:
Mouse   209 VC-----GGRLRGLVSWGDMPCGSKEKPGVYTDVCTHIRWIQNIL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 69/237 (29%)
Tryp_SPc 41..273 CDD:214473 67/234 (29%)
Klk6NP_001158168.1 Tryp_SPc 28..244 CDD:214473 67/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.