DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and St14

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_036010597.1 Gene:St14 / 19143 MGIID:1338881 Length:875 Species:Mus musculus


Alignment Length:235 Identity:77/235 - (32%)
Similarity:116/235 - (49%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYLVSL-SLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFN-GDAVGTPVYAGIINRSNVTAAQ 116
            |:.||| :|.:.   ||||||:|...||::||||..:.:.|. .|......:.|::::|..:|:.
Mouse   647 PWQVSLHALGQG---HLCGASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAFLGLLDQSKRSASG 708

  Fly   117 VRYVDFAS--THRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDY-SNKTAAAYGWGLT 178
            |:.:....  ||.|||......:||||.:.:|.||:..|:.|.|||....: :.|.....|||.|
Mouse   709 VQELKLKRIITHPSFNDFTFDYDIALLELEKSVEYSTVVRPICLPDATHVFPAGKAIWVTGWGHT 773

  Fly   179 DPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVC-----SQVKTCYGDGGTPLIYWPIT 238
             .:|...:..||.....::|.|.|::|:|..  :|.:.:|     ..|.:|.||.|.||......
Mouse   774 -KEGGTGALILQKGEIRVINQTTCEDLMPQQ--ITPRMMCVGFLSGGVDSCQGDSGGPLSSAEKD 835

  Fly   239 GPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTIG 278
            |.....|:.||. ..|...|:|.|||.:|....||.:..|
Mouse   836 GRMFQAGVVSWG-EGCAQRNKPGVYTRLPVVRDWIKEHTG 874

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 76/231 (33%)
Tryp_SPc 41..273 CDD:214473 74/228 (32%)
St14XP_036010597.1 SEA 108..198 CDD:396113
CUB 247..352 CDD:238001
CUB 360..464 CDD:238001
LDLa 474..506 CDD:238060
LDLa 512..543 CDD:238060
LDLa 545..579 CDD:238060
LDLa 587..622 CDD:238060
Tryp_SPc 635..872 CDD:238113 76/231 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.